URL: | http://pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org/jae/win32.exe |
Full analysis: | https://app.any.run/tasks/a69ec09e-615b-404f-ba3a-9b597673effa |
Verdict: | Malicious activity |
Threats: | FormBook is a data stealer that is being distributed as a MaaS. FormBook differs from a lot of competing malware by its extreme ease of use that allows even the unexperienced threat actors to use FormBook virus. |
Analysis date: | February 18, 2019, 15:51:36 |
OS: | Windows 7 Professional Service Pack 1 (build: 7601, 32 bit) |
Tags: | |
Indicators: | |
MD5: | DDB9D569A44D334E102C896AFC345744 |
SHA1: | 72DF2A59B0510FA588463EED62E5125473917F12 |
SHA256: | 412EF62BB6A43D20D314EC47E83D1D4593A99668F18F16729365BF26117DB821 |
SSDEEP: | 3:N1KOcXiSM2BBMHDWWkAzeFfjnfQmELS58CyaWi8AJNXkAn:COX/m6HDRkAahfQeiSWlArXkA |
PID | CMD | Path | Indicators | Parent process |
---|---|---|---|---|
2980 | "C:\Program Files\Internet Explorer\iexplore.exe" -nohome | C:\Program Files\Internet Explorer\iexplore.exe | explorer.exe | |
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Internet Explorer Exit code: 1 Version: 8.00.7600.16385 (win7_rtm.090713-1255) | ||||
3280 | "C:\Program Files\Internet Explorer\iexplore.exe" SCODEF:2980 CREDAT:71937 | C:\Program Files\Internet Explorer\iexplore.exe | iexplore.exe | |
User: admin Company: Microsoft Corporation Integrity Level: LOW Description: Internet Explorer Exit code: 0 Version: 8.00.7600.16385 (win7_rtm.090713-1255) | ||||
3556 | "C:\Users\admin\AppData\Local\Microsoft\Windows\Temporary Internet Files\Content.IE5\RB73MZ6Y\win32[1].exe" | C:\Users\admin\AppData\Local\Microsoft\Windows\Temporary Internet Files\Content.IE5\RB73MZ6Y\win32[1].exe | iexplore.exe | |
User: admin Company: Company Name Integrity Level: MEDIUM Description: File Description Exit code: 0 Version: 1.00 | ||||
3268 | "C:\Windows\System32\WScript.exe" "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.vbs" | C:\Windows\System32\WScript.exe | win32[1].exe | |
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Microsoft ® Windows Based Script Host Exit code: 0 Version: 5.8.7600.16385 | ||||
3344 | "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe" | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe | — | win32[1].exe |
User: admin Company: Company Name Integrity Level: MEDIUM Description: File Description Exit code: 3221226540 Version: 1.00 | ||||
1228 | "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe" | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe | win32[1].exe | |
User: admin Company: Company Name Integrity Level: HIGH Description: File Description Exit code: 0 Version: 1.00 | ||||
4032 | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe" | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe | — | MsOffice2019patch.exe |
User: admin Company: Company Name Integrity Level: HIGH Description: File Description Exit code: 0 Version: 1.00 | ||||
1340 | "C:\Windows\System32\svchost.exe" | C:\Windows\System32\svchost.exe | explorer.exe | |
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Host Process for Windows Services Version: 6.1.7600.16385 (win7_rtm.090713-1255) | ||||
1372 | /c del "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe" | C:\Windows\System32\cmd.exe | — | svchost.exe |
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Windows Command Processor Exit code: 0 Version: 6.1.7601.17514 (win7sp1_rtm.101119-1850) | ||||
116 | C:\Windows\Explorer.EXE | C:\Windows\explorer.exe | — | |
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Windows Explorer Version: 6.1.7600.16385 (win7_rtm.090713-1255) |
PID | Process | Filename | Type | |
---|---|---|---|---|
2980 | iexplore.exe | C:\Users\admin\AppData\Local\Temp\~DF0F3B94F7CE14DFF6.TMP | — | |
MD5:— | SHA256:— | |||
2980 | iexplore.exe | C:\Users\admin\AppData\Local\Temp\~DFA5526E2D262A2229.TMP | — | |
MD5:— | SHA256:— | |||
2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Internet Explorer\Recovery\Active\RecoveryStore.{21B21B5B-3395-11E9-BAD8-5254004A04AF}.dat | — | |
MD5:— | SHA256:— | |||
3556 | win32[1].exe | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe | executable | |
MD5:A86145C76A7CE5BA98BDE1D3441DE3C7 | SHA256:F2A24F11EB69B0B239355B0948BB09E585D2AD639E48FF350B876780F7128089 | |||
2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\Temporary Internet Files\Content.IE5\RB73MZ6Y\win32[1].exe | executable | |
MD5:A86145C76A7CE5BA98BDE1D3441DE3C7 | SHA256:F2A24F11EB69B0B239355B0948BB09E585D2AD639E48FF350B876780F7128089 | |||
3556 | win32[1].exe | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.vbs | text | |
MD5:63DF9FC38CFF6353444F117700F10955 | SHA256:4A7F650FF3C0FDC9F9B847982375016193C3612C3F031C638C02A491E1102DB0 | |||
2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\History\History.IE5\MSHist012019021820190219\index.dat | dat | |
MD5:2D502425AB812156EDE32BC8037DA599 | SHA256:CB1F72D0F96D357FC1DB1F066EB946F4015E796328220F1CC1D585F1BDB3FEBC | |||
3280 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\History\Low\History.IE5\MSHist012019021820190219\index.dat | dat | |
MD5:D82E457721B849B7B31A98F93E5A5F29 | SHA256:1196C1C242029BC40BAEA5D279F25929455A4EB60263D2DB1DD32A6E7F4D553D | |||
2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Internet Explorer\Recovery\Active\{21B21B5C-3395-11E9-BAD8-5254004A04AF}.dat | binary | |
MD5:8771709DB532F03EB74E69306886FFF6 | SHA256:F395145C42F2C14696CB757E1714B12B19C864F961973171A7A2D91F47459073 | |||
3280 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\Temporary Internet Files\Low\Content.IE5\OCDM6JB6\win32[1].exe | executable | |
MD5:A86145C76A7CE5BA98BDE1D3441DE3C7 | SHA256:F2A24F11EB69B0B239355B0948BB09E585D2AD639E48FF350B876780F7128089 |
PID | Process | Method | HTTP Code | IP | URL | CN | Type | Size | Reputation |
---|---|---|---|---|---|---|---|---|---|
116 | explorer.exe | GET | — | 199.192.23.100:80 | http://www.kervax.com/jw/?FPxL=PKmiM4JY2DU3mZ7YdpyehhCFg00ivQx3ST4LQG7oGDNsHdXseWS+JNlNtyZ/lTOs4Wx2ng==&BlD=8pmdRTbpUB&sql=1 | US | — | — | malicious |
116 | explorer.exe | GET | 301 | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/?FPxL=VgssHczy1Q6av0SVn+cbTmDI7SGqsehk2v9ajFoxWMTorxqrc3p1mbyGjXig7zmJhgmPIg==&BlD=8pmdRTbpUB | US | html | 776 b | malicious |
116 | explorer.exe | GET | 404 | 94.136.40.51:80 | http://www.beverleycrown.com/jw/?FPxL=3e6rf10e2CJUXnTA4vVI3J4lZxt4ksHXus7y0Ifo6YYGGT7XgbRMA89bYfM1rXjxmhiEUA==&BlD=8pmdRTbpUB | GB | html | 945 b | malicious |
3280 | iexplore.exe | GET | 200 | 23.249.161.100:80 | http://pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org/jae/win32.exe | US | executable | 633 Kb | malicious |
116 | explorer.exe | POST | 404 | 199.192.23.100:80 | http://www.kervax.com/jw/ | US | html | 288 b | malicious |
116 | explorer.exe | POST | — | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/ | US | — | — | malicious |
116 | explorer.exe | POST | — | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/ | US | — | — | malicious |
116 | explorer.exe | POST | 404 | 199.192.23.100:80 | http://www.kervax.com/jw/ | US | html | 288 b | malicious |
116 | explorer.exe | POST | — | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/ | US | — | — | malicious |
PID | Process | IP | Domain | ASN | CN | Reputation |
---|---|---|---|---|---|---|
2980 | iexplore.exe | 204.79.197.200:80 | www.bing.com | Microsoft Corporation | US | whitelisted |
3280 | iexplore.exe | 23.249.161.100:80 | pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org | ColoCrossing | US | malicious |
116 | explorer.exe | 94.136.40.51:80 | www.beverleycrown.com | Host Europe GmbH | GB | malicious |
116 | explorer.exe | 199.192.23.100:80 | www.kervax.com | — | US | malicious |
116 | explorer.exe | 199.34.228.59:80 | www.sweetsenbake.com | Weebly, Inc. | US | malicious |
Domain | IP | Reputation |
---|---|---|
www.bing.com |
| whitelisted |
pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org |
| malicious |
www.beverleycrown.com |
| malicious |
www.kervax.com |
| malicious |
www.sweetsenbake.com |
| malicious |
PID | Process | Class | Message |
---|---|---|---|
— | — | Misc activity | ET INFO DYNAMIC_DNS Query to *.duckdns. Domain |
— | — | Misc activity | ET INFO DYNAMIC_DNS Query to *.duckdns. Domain |
— | — | Misc activity | ET INFO DYNAMIC_DNS Query to *.duckdns. Domain |
3280 | iexplore.exe | Potential Corporate Privacy Violation | ET POLICY PE EXE or DLL Windows file download HTTP |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] FormBook CnC Checkin (GET) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] FormBook CnC Checkin (GET) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] TrojanSpy:FormBook CnC Checkin (POST) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] TrojanSpy:FormBook CnC Checkin (POST) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] FormBook CnC Checkin (GET) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] TrojanSpy:FormBook CnC Checkin (POST) |