| URL: | http://pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org/jae/win32.exe |
| Full analysis: | https://app.any.run/tasks/a69ec09e-615b-404f-ba3a-9b597673effa |
| Verdict: | Malicious activity |
| Threats: | FormBook is a data stealer that is being distributed as a MaaS. FormBook differs from a lot of competing malware by its extreme ease of use that allows even the unexperienced threat actors to use FormBook virus. |
| Analysis date: | February 18, 2019, 15:51:36 |
| OS: | Windows 7 Professional Service Pack 1 (build: 7601, 32 bit) |
| Tags: | |
| Indicators: | |
| MD5: | DDB9D569A44D334E102C896AFC345744 |
| SHA1: | 72DF2A59B0510FA588463EED62E5125473917F12 |
| SHA256: | 412EF62BB6A43D20D314EC47E83D1D4593A99668F18F16729365BF26117DB821 |
| SSDEEP: | 3:N1KOcXiSM2BBMHDWWkAzeFfjnfQmELS58CyaWi8AJNXkAn:COX/m6HDRkAahfQeiSWlArXkA |
MALICIOUS
Uses SVCHOST.EXE for hidden code execution
- explorer.exe (PID: 116)
Application was dropped or rewritten from another process
- MsOffice2019patch.exe (PID: 4032)
- win32[1].exe (PID: 3556)
- MsOffice2019patch.exe (PID: 3344)
- MsOffice2019patch.exe (PID: 1228)
- knjhvhlnjl.exe (PID: 1932)
- MsOffice2019patch.exe (PID: 3932)
- MsOffice2019patch.exe (PID: 4056)
FORMBOOK was detected
- explorer.exe (PID: 116)
Downloads executable files from the Internet
- iexplore.exe (PID: 3280)
Changes the autorun value in the registry
- WScript.exe (PID: 3268)
- svchost.exe (PID: 1340)
- WScript.exe (PID: 3804)
Connects to CnC server
- explorer.exe (PID: 116)
Formbook was detected
- svchost.exe (PID: 1340)
- Firefox.exe (PID: 2096)
Actions looks like stealing of personal data
- svchost.exe (PID: 1340)
Stealing of credential data
- svchost.exe (PID: 1340)
SUSPICIOUS
Application launched itself
- MsOffice2019patch.exe (PID: 1228)
Starts CMD.EXE for commands execution
- svchost.exe (PID: 1340)
Starts Internet Explorer
- explorer.exe (PID: 116)
Executable content was dropped or overwritten
- iexplore.exe (PID: 3280)
- iexplore.exe (PID: 2980)
- win32[1].exe (PID: 3556)
- explorer.exe (PID: 116)
- DllHost.exe (PID: 3296)
- knjhvhlnjl.exe (PID: 1932)
Executes scripts
- win32[1].exe (PID: 3556)
- knjhvhlnjl.exe (PID: 1932)
Starts itself from another location
- win32[1].exe (PID: 3556)
- knjhvhlnjl.exe (PID: 1932)
Creates files in the user directory
- svchost.exe (PID: 1340)
Loads DLL from Mozilla Firefox
- svchost.exe (PID: 1340)
Creates files in the program directory
- DllHost.exe (PID: 3296)
INFO
Reads Internet Cache Settings
- iexplore.exe (PID: 3280)
- iexplore.exe (PID: 2980)
Changes internet zones settings
- iexplore.exe (PID: 2980)
Application launched itself
- iexplore.exe (PID: 2980)
Creates files in the user directory
- Firefox.exe (PID: 2096)
Find more information about signature artifacts and mapping to MITRE ATT&CK™ MATRIX at the full report
Total processes
53
Monitored processes
16
Malicious processes
7
Suspicious processes
0
Behavior graph
Click at the process to see the details
Process information
PID | CMD | Path | Indicators | Parent process | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 116 | C:\Windows\Explorer.EXE | C:\Windows\explorer.exe | — | ||||||||||||
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Windows Explorer Exit code: 0 Version: 6.1.7600.16385 (win7_rtm.090713-1255) Modules
| |||||||||||||||
| 1228 | "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe" | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe | win32[1].exe | ||||||||||||
User: admin Company: Company Name Integrity Level: HIGH Description: File Description Exit code: 0 Version: 1.00 Modules
| |||||||||||||||
| 1340 | "C:\Windows\System32\svchost.exe" | C:\Windows\System32\svchost.exe | explorer.exe | ||||||||||||
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Host Process for Windows Services Exit code: 0 Version: 6.1.7600.16385 (win7_rtm.090713-1255) Modules
| |||||||||||||||
| 1372 | /c del "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe" | C:\Windows\System32\cmd.exe | — | svchost.exe | |||||||||||
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Windows Command Processor Exit code: 0 Version: 6.1.7601.17514 (win7sp1_rtm.101119-1850) Modules
| |||||||||||||||
| 1932 | "C:\Program Files\Ufzd0txix\knjhvhlnjl.exe" | C:\Program Files\Ufzd0txix\knjhvhlnjl.exe | explorer.exe | ||||||||||||
User: admin Company: Company Name Integrity Level: MEDIUM Description: File Description Exit code: 0 Version: 1.00 Modules
| |||||||||||||||
| 2096 | "C:\Program Files\Mozilla Firefox\Firefox.exe" | C:\Program Files\Mozilla Firefox\Firefox.exe | svchost.exe | ||||||||||||
User: admin Company: Mozilla Corporation Integrity Level: MEDIUM Description: Firefox Exit code: 0 Version: 61.0.2 Modules
| |||||||||||||||
| 2980 | "C:\Program Files\Internet Explorer\iexplore.exe" -nohome | C:\Program Files\Internet Explorer\iexplore.exe | explorer.exe | ||||||||||||
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Internet Explorer Exit code: 1 Version: 8.00.7600.16385 (win7_rtm.090713-1255) Modules
| |||||||||||||||
| 3268 | "C:\Windows\System32\WScript.exe" "C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.vbs" | C:\Windows\System32\WScript.exe | win32[1].exe | ||||||||||||
User: admin Company: Microsoft Corporation Integrity Level: MEDIUM Description: Microsoft ® Windows Based Script Host Exit code: 0 Version: 5.8.7600.16385 Modules
| |||||||||||||||
| 3280 | "C:\Program Files\Internet Explorer\iexplore.exe" SCODEF:2980 CREDAT:71937 | C:\Program Files\Internet Explorer\iexplore.exe | iexplore.exe | ||||||||||||
User: admin Company: Microsoft Corporation Integrity Level: LOW Description: Internet Explorer Exit code: 0 Version: 8.00.7600.16385 (win7_rtm.090713-1255) Modules
| |||||||||||||||
| 3296 | C:\Windows\system32\DllHost.exe /Processid:{3AD05575-8857-4850-9277-11B85BDB8E09} | C:\Windows\system32\DllHost.exe | svchost.exe | ||||||||||||
User: admin Company: Microsoft Corporation Integrity Level: HIGH Description: COM Surrogate Exit code: 0 Version: 6.1.7600.16385 (win7_rtm.090713-1255) Modules
| |||||||||||||||
Total events
6 730
Read events
2 857
Write events
3 869
Delete events
4
Modification events
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Internet Explorer\Main |
| Operation: | write | Name: | CompatibilityFlags |
Value: 0 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap |
| Operation: | write | Name: | UNCAsIntranet |
Value: 0 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\ZoneMap |
| Operation: | write | Name: | AutoDetect |
Value: 1 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\Zones |
| Operation: | write | Name: | SecuritySafe |
Value: 1 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings |
| Operation: | write | Name: | ProxyEnable |
Value: 0 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Internet Settings\Connections |
| Operation: | write | Name: | SavedLegacySettings |
Value: 4600000069000000010000000000000000000000000000000000000000000000C0E333BBEAB1D301000000000000000000000000020000001700000000000000FE800000000000007D6CB050D9C573F70B000000000000006D00330032005C004D00530049004D004700330032002E0064006C000100000004AA400014AA4000040000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000002000000C0A8016400000000000000000000000000000000000000000800000000000000805D3F00983740000008000002000000000000600000002060040000B8A94000020000008802000060040000B8A9400004000000F8010000B284000088B64000B84B400043003A000000000000000000000000000000000000000000 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Internet Explorer\Recovery\Active |
| Operation: | write | Name: | {21B21B5B-3395-11E9-BAD8-5254004A04AF} |
Value: 0 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Ext\Stats\{2670000A-7350-4F3C-8081-5663EE0C6C49}\iexplore |
| Operation: | write | Name: | Type |
Value: 4 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Ext\Stats\{2670000A-7350-4F3C-8081-5663EE0C6C49}\iexplore |
| Operation: | write | Name: | Count |
Value: 3 | |||
| (PID) Process: | (2980) iexplore.exe | Key: | HKEY_CURRENT_USER\Software\Microsoft\Windows\CurrentVersion\Ext\Stats\{2670000A-7350-4F3C-8081-5663EE0C6C49}\iexplore |
| Operation: | write | Name: | Time |
Value: E3070200010012000F00340003008D02 | |||
Executable files
6
Suspicious files
77
Text files
6
Unknown types
2
Dropped files
PID | Process | Filename | Type | |
|---|---|---|---|---|
| 2980 | iexplore.exe | C:\Users\admin\AppData\Local\Temp\~DF0F3B94F7CE14DFF6.TMP | — | |
MD5:— | SHA256:— | |||
| 2980 | iexplore.exe | C:\Users\admin\AppData\Local\Temp\~DFA5526E2D262A2229.TMP | — | |
MD5:— | SHA256:— | |||
| 2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Internet Explorer\Recovery\Active\RecoveryStore.{21B21B5B-3395-11E9-BAD8-5254004A04AF}.dat | — | |
MD5:— | SHA256:— | |||
| 3280 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\Temporary Internet Files\Low\Content.IE5\OCDM6JB6\win32[1].exe | executable | |
MD5:— | SHA256:— | |||
| 2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\Temporary Internet Files\Content.IE5\RB73MZ6Y\win32[1].exe | executable | |
MD5:— | SHA256:— | |||
| 2980 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Internet Explorer\Recovery\Active\{21B21B5C-3395-11E9-BAD8-5254004A04AF}.dat | binary | |
MD5:— | SHA256:— | |||
| 3556 | win32[1].exe | C:\Users\admin\AppData\Local\Temp\subfolder\MsOffice2019patch.exe | executable | |
MD5:— | SHA256:— | |||
| 1340 | svchost.exe | C:\Users\admin\AppData\Roaming\2-260UUE\2-2logrc.ini | binary | |
MD5:— | SHA256:— | |||
| 1228 | MsOffice2019patch.exe | C:\Users\admin\AppData\Local\Temp\~DF904E23301F8F38DD.TMP | binary | |
MD5:— | SHA256:— | |||
| 3280 | iexplore.exe | C:\Users\admin\AppData\Local\Microsoft\Windows\History\Low\History.IE5\MSHist012019021820190219\index.dat | dat | |
MD5:— | SHA256:— | |||
Download PCAP, analyze network streams, HTTP content and a lot more at the full report
HTTP(S) requests
9
TCP/UDP connections
11
DNS requests
5
Threats
18
HTTP requests
PID | Process | Method | HTTP Code | IP | URL | CN | Type | Size | Reputation |
|---|---|---|---|---|---|---|---|---|---|
116 | explorer.exe | GET | — | 199.192.23.100:80 | http://www.kervax.com/jw/?FPxL=PKmiM4JY2DU3mZ7YdpyehhCFg00ivQx3ST4LQG7oGDNsHdXseWS+JNlNtyZ/lTOs4Wx2ng==&BlD=8pmdRTbpUB&sql=1 | US | — | — | malicious |
3280 | iexplore.exe | GET | 200 | 23.249.161.100:80 | http://pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org/jae/win32.exe | US | executable | 633 Kb | malicious |
116 | explorer.exe | GET | 404 | 94.136.40.51:80 | http://www.beverleycrown.com/jw/?FPxL=3e6rf10e2CJUXnTA4vVI3J4lZxt4ksHXus7y0Ifo6YYGGT7XgbRMA89bYfM1rXjxmhiEUA==&BlD=8pmdRTbpUB | GB | html | 945 b | malicious |
116 | explorer.exe | POST | 404 | 199.192.23.100:80 | http://www.kervax.com/jw/ | US | html | 288 b | malicious |
116 | explorer.exe | GET | 301 | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/?FPxL=VgssHczy1Q6av0SVn+cbTmDI7SGqsehk2v9ajFoxWMTorxqrc3p1mbyGjXig7zmJhgmPIg==&BlD=8pmdRTbpUB | US | html | 776 b | malicious |
116 | explorer.exe | POST | 404 | 199.192.23.100:80 | http://www.kervax.com/jw/ | US | html | 288 b | malicious |
116 | explorer.exe | POST | — | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/ | US | — | — | malicious |
116 | explorer.exe | POST | — | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/ | US | — | — | malicious |
116 | explorer.exe | POST | — | 199.34.228.59:80 | http://www.sweetsenbake.com/jw/ | US | — | — | malicious |
Download PCAP, analyze network streams, HTTP content and a lot more at the full report
Connections
PID | Process | IP | Domain | ASN | CN | Reputation |
|---|---|---|---|---|---|---|
2980 | iexplore.exe | 204.79.197.200:80 | www.bing.com | Microsoft Corporation | US | whitelisted |
3280 | iexplore.exe | 23.249.161.100:80 | pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org | ColoCrossing | US | malicious |
116 | explorer.exe | 94.136.40.51:80 | www.beverleycrown.com | Host Europe GmbH | GB | malicious |
116 | explorer.exe | 199.192.23.100:80 | www.kervax.com | — | US | malicious |
116 | explorer.exe | 199.34.228.59:80 | www.sweetsenbake.com | Weebly, Inc. | US | malicious |
DNS requests
Domain | IP | Reputation |
|---|---|---|
www.bing.com |
| whitelisted |
pyrzowiceekssiddillfirststepsacademym6web-tracking.cocomputewww.watchdogdns.duckdns.org |
| malicious |
www.beverleycrown.com |
| malicious |
www.kervax.com |
| malicious |
www.sweetsenbake.com |
| malicious |
Threats
PID | Process | Class | Message |
|---|---|---|---|
1056 | svchost.exe | Misc activity | ET INFO DYNAMIC_DNS Query to *.duckdns. Domain |
1056 | svchost.exe | Misc activity | ET INFO DYNAMIC_DNS Query to *.duckdns. Domain |
1056 | svchost.exe | Misc activity | ET INFO DYNAMIC_DNS Query to *.duckdns. Domain |
3280 | iexplore.exe | Potential Corporate Privacy Violation | ET POLICY PE EXE or DLL Windows file download HTTP |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] FormBook CnC Checkin (GET) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] FormBook CnC Checkin (GET) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] TrojanSpy:FormBook CnC Checkin (POST) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] TrojanSpy:FormBook CnC Checkin (POST) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] FormBook CnC Checkin (GET) |
116 | explorer.exe | A Network Trojan was detected | MALWARE [PTsecurity] TrojanSpy:FormBook CnC Checkin (POST) |
6 ETPRO signatures available at the full report