| URL: | https://startsuperrenewedthefile.vip/dqVWV2Obp6LwwkfWGWf_8wF0IH9v_NGEB1IfaGwVb5I/?cid=05a2d8b6194df36db380aaa5dd7b4680&sid=16662177 |
| Full analysis: | https://app.any.run/tasks/6196ba3f-a223-4e08-84ac-d69defaf1e2d |
| Verdict: | Malicious activity |
| Analysis date: | January 24, 2022, 18:22:47 |
| OS: | Windows 7 Professional Service Pack 1 (build: 7601, 32 bit) |
| Indicators: | |
| MD5: | E9A783AC78D6379083974F0AED68CB53 |
| SHA1: | CD445AA95FBB713586C4E214657C2D1E27D64DBB |
| SHA256: | 28A421F616AEDFA4050E82F9734C35A9B192798168AA490D8C11030B9A255676 |
| SSDEEP: | 3:N8cLOQTVDDsQf6riyiQiu7iBHWduEf+OqwSSn:2cSYVD6riyiQ77kW4Op |
PID | CMD | Path | Indicators | Parent process | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| 336 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=renderer --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --lang=en-US --extension-process --device-scale-factor=1 --num-raster-threads=2 --enable-main-frame-before-activation --renderer-client-id=4 --no-v8-untrusted-code-mitigations --mojo-platform-channel-handle=2164 /prefetch:1 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 480 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=gpu-process --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --gpu-preferences=MAAAAAAAAADgACAwAAAAAAAAAAAAAAAAAABgAAAAAAAQAAAAAAAAAAAAAAAAAAAAKAAAAAQAAAAgAAAAAAAAACgAAAAAAAAAMAAAAAAAAAA4AAAAAAAAABAAAAAAAAAAAAAAAAUAAAAQAAAAAAAAAAAAAAAGAAAAEAAAAAAAAAABAAAABQAAABAAAAAAAAAAAQAAAAYAAAA= --mojo-platform-channel-handle=1052 /prefetch:2 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 568 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=utility --utility-sub-type=chrome.mojom.UtilWin --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --lang=en-US --service-sandbox-type=none --mojo-platform-channel-handle=1700 /prefetch:8 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: MEDIUM Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 1372 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=renderer --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --lang=en-US --device-scale-factor=1 --num-raster-threads=2 --enable-main-frame-before-activation --renderer-client-id=6 --no-v8-untrusted-code-mitigations --mojo-platform-channel-handle=1780 /prefetch:1 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 1652 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=utility --utility-sub-type=chrome.mojom.UtilWin --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --lang=en-US --service-sandbox-type=none --mojo-platform-channel-handle=1728 /prefetch:8 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: MEDIUM Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 2152 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=renderer --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --disable-gpu-compositing --lang=en-US --device-scale-factor=1 --num-raster-threads=2 --enable-main-frame-before-activation --renderer-client-id=13 --no-v8-untrusted-code-mitigations --mojo-platform-channel-handle=3520 /prefetch:1 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 2152 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=renderer --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --disable-gpu-compositing --lang=en-US --device-scale-factor=1 --num-raster-threads=2 --enable-main-frame-before-activation --renderer-client-id=20 --no-v8-untrusted-code-mitigations --mojo-platform-channel-handle=4084 /prefetch:1 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 2360 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=renderer --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --disable-gpu-compositing --lang=en-US --device-scale-factor=1 --num-raster-threads=2 --enable-main-frame-before-activation --renderer-client-id=14 --no-v8-untrusted-code-mitigations --mojo-platform-channel-handle=4060 /prefetch:1 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 2420 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=renderer --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --disable-gpu-compositing --lang=en-US --device-scale-factor=1 --num-raster-threads=2 --enable-main-frame-before-activation --renderer-client-id=19 --no-v8-untrusted-code-mitigations --mojo-platform-channel-handle=2812 /prefetch:1 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| 2468 | "C:\Program Files\Google\Chrome\Application\chrome.exe" --type=gpu-process --field-trial-handle=1048,5281354178565124091,16809468298876665269,131072 --enable-features=PasswordImport --gpu-preferences=MAAAAAAAAADgACAwAAAAAAAAAAAAAAAAAABgAAAAAAAQAAAAAAAAAAAAAAAAAAAAKAAAAAQAAAAgAAAAAAAAACgAAAAAAAAAMAAAAAAAAAA4AAAAAAAAABAAAAAAAAAAAAAAAAUAAAAQAAAAAAAAAAAAAAAGAAAAEAAAAAAAAAABAAAABQAAABAAAAAAAAAAAQAAAAYAAAA= --use-gl=swiftshader-webgl --mojo-platform-channel-handle=1132 /prefetch:2 | C:\Program Files\Google\Chrome\Application\chrome.exe | — | chrome.exe | |||||||||||
User: admin Company: Google LLC Integrity Level: LOW Description: Google Chrome Exit code: 0 Version: 86.0.4240.198 Modules
| |||||||||||||||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Chrome\BLBeacon |
| Operation: | write | Name: | failed_count |
Value: 0 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Chrome\BLBeacon |
| Operation: | write | Name: | state |
Value: 2 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Chrome\ThirdParty |
| Operation: | write | Name: | StatusCodes |
Value: | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Chrome\ThirdParty |
| Operation: | write | Name: | StatusCodes |
Value: 01000000 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Chrome\BLBeacon |
| Operation: | write | Name: | state |
Value: 1 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Update\ClientState\{8A69D345-D564-463c-AFF1-A69D9E530F96} |
| Operation: | write | Name: | dr |
Value: 1 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Chrome |
| Operation: | write | Name: | UsageStatsInSample |
Value: 0 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_LOCAL_MACHINE\SOFTWARE\Google\Update\ClientStateMedium\{8A69D345-D564-463C-AFF1-A69D9E530F96} |
| Operation: | write | Name: | usagestats |
Value: 0 | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Update\ClientState\{8A69D345-D564-463c-AFF1-A69D9E530F96} |
| Operation: | write | Name: | metricsid |
Value: | |||
| (PID) Process: | (3004) chrome.exe | Key: | HKEY_CURRENT_USER\Software\Google\Update\ClientState\{8A69D345-D564-463c-AFF1-A69D9E530F96} |
| Operation: | write | Name: | metricsid_installdate |
Value: 0 | |||
PID | Process | Filename | Type | |
|---|---|---|---|---|
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\BrowserMetrics\BrowserMetrics-61EEEE7A-BBC.pma | — | |
MD5:— | SHA256:— | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\f4e46e5b-1994-419a-ad1f-1637b0b6860e.tmp | text | |
MD5:— | SHA256:— | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\Preferences | text | |
MD5:— | SHA256:— | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\Sync Data\LevelDB\LOG.old~RF115001.TMP | text | |
MD5:64AD8ED3E666540337BA541C549F72F7 | SHA256:BECBDB08B5B37D203A85F2E974407334053BB1D2270F0B3C9A4DB963896F2206 | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Crashpad\settings.dat | binary | |
MD5:9C016064A1F864C8140915D77CF3389A | SHA256:0E7265D4A8C16223538EDD8CD620B8820611C74538E420A88E333BE7F62AC787 | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\Site Characteristics Database\LOG.old | text | |
MD5:8FF312A95D60ED89857FEB720D80D4E1 | SHA256:946A57FAFDD28C3164D5AB8AB4971B21BD5EC5BFFF7554DBF832CB58CC37700B | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Last Version | text | |
MD5:00046F773EFDD3C8F8F6D0F87A2B93DC | SHA256:593EDE11D17AF7F016828068BCA2E93CF240417563FB06DC8A579110AEF81731 | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\Local Storage\leveldb\LOG.old~RF115030.TMP | text | |
MD5:81F483F77EE490F35306A4F94DB2286B | SHA256:82434CE3C9D13F509EBEEBE3A7A1A1DE9AB4557629D9FC855761E0CFA45E8BCE | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\Sync Data\LevelDB\LOG.old | text | |
MD5:5BD3C311F2136A7A88D3E197E55CF902 | SHA256:FA331915E1797E59979A3E4BCC2BD0D3DEAA039B94D4DB992BE251FD02A224B9 | |||
| 3004 | chrome.exe | C:\Users\admin\AppData\Local\Google\Chrome\User Data\Default\Session Storage\LOG.old~RF11512a.TMP | text | |
MD5:B628564B8042F6E2CC2F53710AAECDC0 | SHA256:1D3B022BDEE9F48D79E3EC1E93F519036003642D3D72D10B05CFD47F43EFBF13 | |||
PID | Process | Method | HTTP Code | IP | URL | CN | Type | Size | Reputation |
|---|---|---|---|---|---|---|---|---|---|
876 | svchost.exe | HEAD | 403 | 34.104.35.123:80 | http://edgedl.me.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3 | US | — | — | whitelisted |
876 | svchost.exe | HEAD | 200 | 74.125.108.167:80 | http://r2---sn-2gb7sn7y.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3?cms_redirect=yes&mh=8t&mip=45.86.202.16&mm=28&mn=sn-2gb7sn7y&ms=nvh&mt=1643048423&mv=m&mvi=2&pl=24&rmhost=r3---sn-2gb7sn7y.gvt1.com&shardbypass=yes | US | — | — | whitelisted |
876 | svchost.exe | HEAD | 302 | 172.217.18.110:80 | http://redirector.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3 | US | — | — | whitelisted |
876 | svchost.exe | GET | 206 | 74.125.108.167:80 | http://r2---sn-2gb7sn7y.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3?cms_redirect=yes&mh=8t&mip=45.86.202.16&mm=28&mn=sn-2gb7sn7y&ms=nvh&mt=1643048180&mv=m&mvi=2&pl=24&rmhost=r3---sn-2gb7sn7y.gvt1.com&shardbypass=yes | US | binary | 9.47 Kb | whitelisted |
876 | svchost.exe | GET | 302 | 172.217.18.110:80 | http://redirector.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3 | US | html | 576 b | whitelisted |
876 | svchost.exe | GET | 302 | 172.217.18.110:80 | http://redirector.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3 | US | html | 576 b | whitelisted |
876 | svchost.exe | GET | 302 | 172.217.18.110:80 | http://redirector.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3 | US | html | 576 b | whitelisted |
876 | svchost.exe | GET | 206 | 74.125.108.167:80 | http://r2---sn-2gb7sn7y.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3?cms_redirect=yes&mh=8t&mip=45.86.202.16&mm=28&mn=sn-2gb7sn7y&ms=nvh&mt=1643048423&mv=m&mvi=2&pl=24&rmhost=r3---sn-2gb7sn7y.gvt1.com&shardbypass=yes | US | binary | 43.2 Kb | whitelisted |
876 | svchost.exe | GET | 302 | 172.217.18.110:80 | http://redirector.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3 | US | html | 576 b | whitelisted |
876 | svchost.exe | GET | 206 | 74.125.108.167:80 | http://r2---sn-2gb7sn7y.gvt1.com/edgedl/release2/chrome_component/adys6mm2sd23z36ns7e4hcs4hrqq_1.3.36.111/ihnlcenocehgdaegdmhbidjhnhdchfmm_1.3.36.111_win_ac5lwr5427en7czu7myxmee6c7xq.crx3?cms_redirect=yes&mh=8t&mip=45.86.202.16&mm=28&mn=sn-2gb7sn7y&ms=nvh&mt=1643048180&mv=m&mvi=2&pl=24&rmhost=r3---sn-2gb7sn7y.gvt1.com&shardbypass=yes | US | binary | 20.7 Kb | whitelisted |
PID | Process | IP | Domain | ASN | CN | Reputation |
|---|---|---|---|---|---|---|
3788 | chrome.exe | 44.199.74.229:443 | startsuperrenewedthefile.vip | University of California, San Diego | US | unknown |
— | — | 142.250.185.237:443 | accounts.google.com | Google Inc. | US | suspicious |
— | — | 44.199.74.229:443 | startsuperrenewedthefile.vip | University of California, San Diego | US | unknown |
3788 | chrome.exe | 142.250.185.78:443 | clients2.google.com | Google Inc. | US | whitelisted |
3788 | chrome.exe | 142.250.185.237:443 | accounts.google.com | Google Inc. | US | suspicious |
3788 | chrome.exe | 107.20.106.95:443 | mix.aff-track.net | Amazon.com, Inc. | US | unknown |
3788 | chrome.exe | 23.32.238.232:80 | ctldl.windowsupdate.com | XO Communications | US | unknown |
3788 | chrome.exe | 3.226.146.143:443 | syncintenselyrenewedthefile.vip | — | US | unknown |
3788 | chrome.exe | 185.117.134.136:443 | iqbroker.com | Level 3 Communications, Inc. | CY | unknown |
3788 | chrome.exe | 45.60.156.148:443 | affiliate.iqbroker.com | — | US | unknown |
Domain | IP | Reputation |
|---|---|---|
startsuperrenewedthefile.vip |
| unknown |
clients2.google.com |
| whitelisted |
accounts.google.com |
| shared |
ctldl.windowsupdate.com |
| whitelisted |
mix.aff-track.net |
| unknown |
syncintenselyrenewedthefile.vip |
| unknown |
iqbroker.com |
| unknown |
affiliate.iqbroker.com |
| unknown |
www.googletagmanager.com |
| whitelisted |
static.cdnroute.io |
| suspicious |
PID | Process | Class | Message |
|---|---|---|---|
3788 | chrome.exe | Attempted User Privilege Gain | ET INFO Session Traversal Utilities for NAT (STUN Binding Request On Non-Standard High Port) |
3788 | chrome.exe | Attempted User Privilege Gain | ET INFO Session Traversal Utilities for NAT (STUN Binding Request On Non-Standard High Port) |
3788 | chrome.exe | Attempted User Privilege Gain | ET INFO Session Traversal Utilities for NAT (STUN Binding Request On Non-Standard High Port) |